SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015873 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015873
Domain Number 1 Region: 320-454,756-929
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.01e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 51-175
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-28
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 1136-1202
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.14e-19
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 221-290
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.44e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000214
Further Details:      
 
Domain Number 5 Region: 157-216
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015873   Gene: ENSMLUG00000017404   Transcript: ENSMLUT00000017409
Sequence length 1209
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:28307926:28417729:1 gene:ENSMLUG00000017404 transcript:ENSMLUT00000017409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGAPSPGSLQQPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTVIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKESLVTKCPLGLCKVSVIPPTA
LNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYETKLPRQASSSTVVTEDFSEGSEVQQILF
YEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKC
SVLKEKLDSLLKTLDDESQASSSLPTPPPTIAEEAEDGDGTGSSCGSAVDRSMGSACPAR
PQIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEMIVLGLSESEERKDLKS
EDTVCHSESCGVAKHRSLRKVSKSPCEKLISKGSSASLPPQSGSRDGLPALNTKILFPNV
RAGMSGSLPGGSVISRLLINADPFNSEPENLEYYTEKCVMNNYFGIGLDAKISLDFNNKR
DEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAVLNIP
SYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIKLQHHRIAQCRTVKI
SILGEEGVPVQVDGEAWVQPPGYIRIIHKNRAQMLTRDRAFENTLKSWEDKQKCELPRPP
SFSLHLGILSEEEATQMDQFGQAAGALIHSIREIAQSHRDMEQELAHAVNASSKSMDRVY
SKPRTTEGLNCSFVLEMVNNMKALRSETELLLSGKMALQLDPPQKERLGAALAEMDRQLR
KLVDTPWLCQPLEPSDEENVMDLSKRSRSGKFRLVTKFKKEKNSKNRDAHSSLGAPVHLW
GTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILCGIKEL
SRSPPATEA
Download sequence
Identical sequences G1PWT3
ENSMLUP00000015873 XP_006082727.1.53796 ENSMLUP00000015873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]