SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015910 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015910
Domain Number 1 Region: 322-577
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.63e-107
Family STAT DNA-binding domain 0.000000000172
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 5.1e-64
Family STAT 0.00000000791
Further Details:      
 
Domain Number 3 Region: 578-716
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-42
Family SH2 domain 0.000000106
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015910   Gene: ENSMLUG00000017449   Transcript: ENSMLUT00000017453
Sequence length 773
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:1451380:1472290:1 gene:ENSMLUG00000017449 transcript:ENSMLUT00000017453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRNRLLVKFPEL
NYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRC
GNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASIL
WYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVN
YSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAIL
STKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYK
IMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSCAAPYLKTKFICVTPTT
CSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences G1PWW4
ENSMLUP00000015910 ENSMLUP00000015910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]