SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015980 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015980
Domain Number 1 Region: 213-313
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-28
Family Ras-binding domain, RBD 0.0000027
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-23
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 965-1062
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 372-468
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.46e-20
Family FHA domain 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015980   Gene: ENSMLUG00000017523   Transcript: ENSMLUT00000017528
Sequence length 1793
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430789:39221:106453:1 gene:ENSMLUG00000017523 transcript:ENSMLUT00000017528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERRLDVEEKPLVVQLNWNKDDREGRFVLKNENDAAPPKKAQSNGPEKQEKEGVI
QNFKRTLSKKEKKEKKKREKEALRQAPDREDGPFRGEDVENSRLAAEVYKDMPETSFTRT
ISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLRPNIPYKTILLSTTDPA
DFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDDKGAKEMVLDDDECPLQIFREWPS
DRGILVFQLKRRPPDYVPRKTKKHLDGRPTKGKERADGAGYGSALPPEKLPYLVELSPGR
RNHFAYCSSHAHEDGSDSRDKPKLYRLQLSVTEVGTDKFDDSSIQLFGSGIQPHHCDLTN
MDGVVTVTPRSMDAETYVEGQRISETTMLQSGMSVQFGAQHVFKFVDPSQDHALGKRPVD
GGLPAKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSSTRLDSDRVSSACSTAERGMVKP
MVRVEQQPEYRWQESRTQDAPGPELVLPASIEFRESSEDSFLSAIINYTNSSTVHFKLSP
TYVLYMACRYVLSSQYRPEVSPPERTHKVIAIVNKMVSMMDGVIQKQKNIAGALAFWMAN
ASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSL
QRPKIDDVLHTLSGAMALLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPESGLCSHY
WGAIIRQQLGHVEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPEDIPNISSTCFKLN
SLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFL
LPEDGYSCDVVRNLPSGLQEFLDPLCQRGFCRLVPHARSPGTWTIHFEGADYESHLLREN
TELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRLS
DRRGSGKPRPKSEGFELYSNSAPNGSPESPPLPWAEYSEPKKLPGDDRLLKNRADHRSSP
NVANQPPSPGGKGAYAPGTAAKITSVSTGNLCAEEQTPPPRPEAYPIPTQTYTREYFTFP
ASKSQDRAAPPPPPPHSQWPPYEEEPLVHTDGSHPSLAVQRVARSQEELREDKAYHLEHH
RVEAVMDRKSDSDLWINQSSSVGSSASSQEHLDHASKPGTPASTLTKSGPGRWKTPATGQ
PAPAAVPQPGRTDLPPPPPPPPMHYASEFDGIPMDLPLPPPPASQLGPQSAQVAAAERKK
REEHQRWYEKEKARLEEERERKRREQERKLGQMRTQSLNPAPFSPVTVQPLKPEKPATLP
RPPETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQLH
IVDMLSREIQELQGKAERSAEESDRLRKLLLEWQFQKRLQESKEKDEDDEEEEEDVDTML
LTQRLEAERRARLQDEERRRQQQLEEMRLREAEERARQEDQRLRQEEERGRRDAEEKRRQ
EEGYYSRLEAERRRLHDEADRRLLEPEEPALSRPPLPRGYEPTALPAPAGAPPPPPQRTT
SSLQAQALSPDSLYTAKLVAYTEEEEEEESPAGKGPNSFTGSSGTLAGAHDAHWDPREKL
SKSHEAGVPGGAGAPENLTFRERQRLFSQGQDVSHKVKASRRLTELENELNTK
Download sequence
Identical sequences G1PX25
ENSMLUP00000015980 ENSMLUP00000015980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]