SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015982 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015982
Domain Number 1 Region: 120-398
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-75
Family Protein kinases, catalytic subunit 0.00000000014
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000126
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 885-921
Classification Level Classification E-value
Superfamily UBA-like 0.0000109
Family UBA domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015982
Domain Number - Region: 923-958
Classification Level Classification E-value
Superfamily UBA-like 0.0454
Family UBA domain 0.015
Further Details:      
 
Domain Number - Region: 6-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0489
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015982   Gene: ENSMLUG00000017526   Transcript: ENSMLUT00000017530
Sequence length 965
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:703136:720635:1 gene:ENSMLUG00000017526 transcript:ENSMLUT00000017530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPPHHSQSAFPKTSPTPGGPAGEGPLQSLTCL
IGEKDLRLFEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
KIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKKPTYDPVSEDQDPLSSDFKRPGVRKP
GLPRGLWLTKPSARVSGTKTGRSGGGAEVTLIDFGEEPVVPSPRPYTPSLAQLAMDACSL
LDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEVCSINSTLVGGVS
PGASQGETNYGFVEQARALPLEDNLFFSLQGGSKAAPPSAQTAEIFALQQECMLRLQVPA
SSLVLSPQARGPMTRPQGAPPGPSLHQSLPSEHKYATPLVIQAPGPRAGPCILPIVRDGK
KVSNHYYLLPERPPYLERYQRFLREAQSPEEPTPLPVPLLPPPSTPAPAAPTATVRPMPQ
AAPDPKANFSTNNSNPGVRPPALRATAWLSQRGCPGDGPEAVRPTDKIQMLQAMVHGVTT
EECQAALQSHSWNVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSCG
PAHHK
Download sequence
Identical sequences G1PX27
ENSMLUP00000015982 ENSMLUP00000015982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]