SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016015 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016015
Domain Number 1 Region: 485-610
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-20
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 23-201
Classification Level Classification E-value
Superfamily ARM repeat 0.000000102
Family HspBP1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016015   Gene: ENSMLUG00000017561   Transcript: ENSMLUT00000017566
Sequence length 664
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:1774791:2033688:1 gene:ENSMLUG00000017561 transcript:ENSMLUT00000017566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNRNEIKNGTILRLTTSPARNAQDLHERIQSSSMDSKLEALKDLASLSRDVTFAQEFINL
DGIFLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKK
IASFVNKSGMDTSILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQTYT
IAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVLTFN
LLEDRMMTKMDPQDQAQRDIIFELRRIAFDAEPEPNASSGSMEKRKSMYTRDYKKLGFIN
HVNPAMDFTQTPPGMLALDNMLYFAKQHQDAYIRIVLENSSREDKHECPFGRSSIELTKM
LCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQV
VKEQVMRALSTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPE
ILELIKQQRLNRLVEGTCFRKLNSRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDS
LQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYC
IWTDGLNALLGKDMLSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFV
YDCN
Download sequence
Identical sequences G1PX58
ENSMLUP00000016015 ENSMLUP00000016015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]