SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016016 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016016
Domain Number 1 Region: 424-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-57
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 219-338
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-29
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 129-233
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-20
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 4 Region: 86-136
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000000746
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016016   Gene: ENSMLUG00000017563   Transcript: ENSMLUT00000017567
Sequence length 636
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:6573862:6603348:-1 gene:ENSMLUG00000017563 transcript:ENSMLUT00000017567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHSDKGTDPPDKEDLKRSTPSNPEDGLSQILRLVLQELNLFYSRDVSGLCLLYDLLHSP
WLQALLKVYDCLQEFKGKKLLPATSQAQALSHEVVEMLQAAPGSPEIQELRQILQAPHFK
ALLSAHDTVAQKDFEPLLPPLPDNIPEGEEAMRIVCLVKNQQPLGATIKRHEMTGDILVA
RVIHGGLAERSGLLYAGDKLVEVNGVAVEGLDPEQVIHILAMSRGTIMFKVVPVSDPPVN
SQKMVYVRAMTEYWPQEDPTIPCAEAGLPFQKGDILQVVDQSDALWWQARKVSALGTCAG
LIPSSHLLKRKQREFWWSQPYQPHTHLKSPMSISMEEEDDMKIDEKCVEAGKTIDEETFE
SEELSEDKEEFVGYGQKFFIAGFRRSMRLCRRRSLLPTLCCPSSCPSAAGAPYEEVVRHQ
RCPSDKHRLIVLVGPSGVGVNELRRQLIELNPGRFRTAVPHTTRSKKSYEVDGREYHYVS
KETFESLMCSHRMLEYGEYKGHFYGTSVDAVQAVLDEGMICVMDLEPQGIQVARTHELKP
YVIFIKPSNLSCMKQSRKNAKIITDYFVDMKFKDEDLQEMEDLAQKMETQFGQFFDHVIV
NDILQDACAQLVSAVQKAQEEPQWVPATWVSSETGS
Download sequence
Identical sequences G1PX59
ENSMLUP00000016016 ENSMLUP00000016016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]