SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016089 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016089
Domain Number 1 Region: 24-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-69
Family FCH domain 0.0046
Further Details:      
 
Domain Number 2 Region: 371-433
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-18
Family SH3-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016089   Gene: ENSMLUG00000017640   Transcript: ENSMLUT00000017644
Sequence length 434
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:3089495:3094014:1 gene:ENSMLUG00000017640 transcript:ENSMLUT00000017644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDTMAPEEDTGGEALEGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQL
ADWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLHGQDSERVRAWQRGA
FHRPVLGGFRESRAAEDSFRKAQKPWLKRLKEVEASKKSYHGARKEEKTAQTRESHAKAD
STVSQDQLRKLQVRVDRCTKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQ
RLLFFKDMLLTLHQHLDLSSSERFHELHRDLHQGIEAASDEQDLRWWRSTHGPGMATHWP
QFEEWSLDTQRTINRKEKGGRSPDEVTLTSIGPTRDGAVPPPQSPVSPGDLGHPGAVISG
QDEEWSDEETPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQS
GRIGLYPANYVECV
Download sequence
Identical sequences G1PXC3
ENSMLUP00000016089 ENSMLUP00000016089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]