SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016094 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016094
Domain Number 1 Region: 344-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-73
Family Protein kinases, catalytic subunit 0.00000000166
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-26
Family Ras-binding domain, RBD 0.0000114
Further Details:      
 
Domain Number 3 Region: 130-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000792
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016094   Gene: ENSMLUG00000017645   Transcript: ENSMLUT00000017649
Sequence length 648
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:13117334:13144797:1 gene:ENSMLUG00000017645 transcript:ENSMLUT00000017649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLMDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTLGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
Download sequence
Identical sequences G1PXC8 L5M7M4
ENSMLUP00000016094 ENSMLUP00000016094 XP_006083884.1.53796 XP_006758353.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]