SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016102 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016102
Domain Number 1 Region: 527-727
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-21
Family SPRY domain 0.0065
Further Details:      
 
Domain Number 2 Region: 221-285
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000488
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 449-530
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000302
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000144
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000016102
Domain Number - Region: 166-216
Classification Level Classification E-value
Superfamily RING/U-box 0.0353
Family ZZ domain 0.036
Further Details:      
 
Domain Number - Region: 269-359
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016102   Gene: ENSMLUG00000017654   Transcript: ENSMLUT00000017658
Sequence length 738
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:12014128:12043794:1 gene:ENSMLUG00000017654 transcript:ENSMLUT00000017658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQHENLKHFTSITVAAVIFKVTIKNIERELICPACKELFTHPLILPCQHNICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLWVNSPSLDKIDRINRPDPDLLYNVTKQGLTNYTGWKR
NSLTPKTTIFPCPGCEHDVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPP
PQESTKSCMDCSASYCNECFKIYHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERVNMY
CELCRRPVCHLCKLGGGNHSNHRVTTMSSAYKTLKEKLSKDINYLIGKESQVKSQISELN
LLMKETECNGERAKEDAITHFEKLFEILEERKSSVLKAIDASKKLRLDKFQTQMEEYQGL
LENNGLVGYAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVINTSK
QTELLGELSFFSSGIDVPEINEEQSKVYNNALINWHQPEKDTADSYVLEYRKINRDQEML
SWNEVEVCGTSKVISELESNCNYAFRVRAYKGSICSPCSRELILHTPPAPVFNFLFDEKC
GYNNEHLLLNLKRDRVESRAGFNLLLAAERIQVGYYTSLDYIIGDVGITKGKHFWAFRVE
PYSYLVKAGVASSDKLQEWLRSPRDAVSPRYEQDSGHDSGSEDACFDSSQRFTLVTIGMK
KFFIPKSPTFNEAENRVLPMPTSIGVFLDYDKGKVGFYDMDHMKCLYERQVDCSSTMYPA
FALMGSGGIQLEEPIMTK
Download sequence
Identical sequences G1PXD5
ENSMLUP00000016102 ENSMLUP00000016102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]