SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016140 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016140
Domain Number 1 Region: 26-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-48
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 251-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000222
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016140   Gene: ENSMLUG00000017696   Transcript: ENSMLUT00000017700
Sequence length 294
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429816:4596920:4617413:1 gene:ENSMLUG00000017696 transcript:ENSMLUT00000017700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDREPPSRIGSKPSDLGDFSATRFLSNPLMGGVESDWSPMHEAAINGRLLSLRRLISQGW
GVNIITADCVSPLHEACLGGHPACASILLKHGAEVDGVTTDWHTPLFNACVSGSQECVNL
LLQYGASPHPACDLASPIHEAAKRGHMGCIESIAAHGGNIDYHISHLGTPLYLACENKQI
ACVKKLLESGVNVNRGRDLESPLHAVARASNEEMATLLLDFGADMQAKNAEGKRPFELVS
PDDPLFQLFMQREEPPSLMQLCRLQIRKCFGIQQHHKINELLLPDELKNFLLHS
Download sequence
Identical sequences G1PXH1
ENSMLUP00000016140 XP_006088650.1.53796 XP_014311212.1.53796 ENSMLUP00000016140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]