SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016145 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016145
Domain Number 1 Region: 369-639
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-77
Family Protein kinases, catalytic subunit 0.0000000143
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-43
Family Pleckstrin-homology domain (PH domain) 0.0000501
Further Details:      
 
Domain Number 3 Region: 266-412
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-34
Family SH2 domain 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016145   Gene: ENSMLUG00000017701   Transcript: ENSMLUT00000017705
Sequence length 650
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429816:4381112:4420219:-1 gene:ENSMLUG00000017701 transcript:ENSMLUT00000017705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIDIKNI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQNEIRGNPHLLIKY
HSGFFVEGKFLCCQQSCKAAPGCTLWEAYADLHIATKEEKLRLPAFPDRMLKIPRAVPIF
KMDEPSSSTALVQYESNSKKRYDSQPNVNMQYVPMEECPDWWQVRQLKSSGDFACSNQRE
KTVNHSTSKMSWGFPESSSSEEEENLDNQDWFAGNISRSQAEQLLRQKGKEGAFMVRNSS
QVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMI
TRLRHPVSTKANKVPTSVSLGSGIWELKREEITLLKELGSGQFGVVHLGKWKGQYDVAIK
MIKEGSMSEDEFFQEAQTMMKLNHPKLVKFYGVCSKIYPIYIVTEYITNGCLLNYLKSHG
KGLETYQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDGDLSVKVSDFGMTRYVLDDQ
YVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVVKV
SQGHRLYRPKLASDTVYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKP
Download sequence
Identical sequences G1PXH6
ENSMLUP00000016145 ENSMLUP00000016145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]