SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016155 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016155
Domain Number 1 Region: 601-766,818-967
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-81
Family Protein kinases, catalytic subunit 0.00000155
Further Details:      
 
Domain Number 2 Region: 97-137
Classification Level Classification E-value
Superfamily UBA-like 2.04e-17
Family UBA domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016155   Gene: ENSMLUG00000017711   Transcript: ENSMLUT00000017715
Sequence length 1044
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429786:5084478:5163226:-1 gene:ENSMLUG00000017711 transcript:ENSMLUT00000017715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSTHGPPVGPSDTSLDTNVLGGKDIARQQ
QPRTAPKFGPYQKALREIRYSLLPFANESGPPVSAEVNRQMLQELVNAGCDQEMAGRALK
QTGSRSIEAALDYISKMGYLDPRKEQIVRVIKQTSPGKGLASTSVPRRPSFEGGGDPCPP
YHSMSGAYESSGVLEEVPRQYMDFLFASVSPHSTLGGLQHQSKGYSASLETAGMNFPVAG
PEGQGVLLQSPHYRPHLLVPGAPLGYGVQRSPSFQNKVPPDTAGYASLAAKGPAGQPGAG
HPFPVVGATAGLYMSHPHHKQAPQVHVMAPPQSLLAPSRNSLNVDLYEASSTPVQSWPVP
TLARRDSMQKQALGLEGSVPSRSSSFSNHQQPVAAASPNTITAVTAAHILHPVKSVRVLR
PEPQTAVGPSHPAWVPAPTPGPEGPGSTDEQPPPLVGVGPYPRDVDVRCPPPPYPKHLLR
GAVEQVDMDCLCAGVEQRLWGTPSEPPNRGHKGAKADRAGKDKKLIQTSPVPVRKNSHDE
EKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQEMARAGLCEAEQEQMRKI
LYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNR
NQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEIFPEHL
ARFYIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQK
GAKGSHIRQDSMEPGDLWDEVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEV
LLRKGYTQLCDWWSVGVILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEA
RDLIIKLCCAADHRLGRNGADDLKAHPFFVTIDFSSDIRKQPAPYIPKISHPMDTSNFDP
IDEESPWNDASEDSTKAWDTLTFPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEAL
QAENSNLENSNLVDQTEGCQPVYV
Download sequence
Identical sequences G1PXI3
ENSMLUP00000016155 ENSMLUP00000016155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]