SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016245 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016245
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000209
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 115-145
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000233
Family Ankyrin repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016245   Gene: ENSMLUG00000004589   Transcript: ENSMLUT00000027118
Sequence length 343
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:756138:768912:-1 gene:ENSMLUG00000004589 transcript:ENSMLUT00000027118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRNIPEAPEEEEEEPQAPLREQDLKETYIQLVQGVQEWQDGCVYRGHFGLDMKLGYGEFS
WPTGESYHGQFYRDHRHGFGTYMWPDGSSFTGMFYLSFREGYGTMYMKTRLFQIHCHINI
INLLLDNGADVNKCTDEGLTPLNMCFLLYYPATSFRPNIAERTVPEPQPPTPFPPLPFAT
VTSLSSQLPTSFPSPHGPGSGAVGPHPQREVPTPRSRPRALIVSHERRHAQPLGLLSSSV
LALKGTVKWESTLPRGSVSISDQGQELEDVLESLDRCTPCSSTETNFESNHCVQNYSIRL
SWNMLEKSARAYSMLKVPSPEAISDKGTMRQMAWTMTNACALS
Download sequence
Identical sequences G1PXR3
ENSMLUP00000016245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]