SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016306 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016306
Domain Number 1 Region: 346-549
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.85e-58
Family Nucleotide and nucleoside kinases 0.0000153
Further Details:      
 
Domain Number 2 Region: 193-336
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 114-214
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-17
Family PDZ domain 0.00067
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000706
Family L27 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016306   Gene: ENSMLUG00000006787   Transcript: ENSMLUT00000026109
Sequence length 553
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429819:5426999:5453969:-1 gene:ENSMLUG00000006787 transcript:ENSMLUT00000026109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLDNLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSVNNQ
LLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGH
EVGNNPKELQELLKNISGSVTLKILPSYRDTIIPQQSGISMERHPAHVRQVFVKCHFDYN
PYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFV
RRDWDNSGPFCGTLSSKKKKKMMYLTTRNAEFDRHEIQIYEEVARMPPFQRRTLVLIGAQ
GVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQGYKFVSRSEMEADIKAGKYLEH
GEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAM
HKAVVDAGIATKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIENL
RMEPQWVPISWVY
Download sequence
Identical sequences G1PXX4
ENSMLUP00000006192 XP_014311392.1.53796 ENSMLUP00000016306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]