SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016371 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016371
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.08e-34
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016371   Gene: ENSMLUG00000026322   Transcript: ENSMLUT00000026885
Sequence length 300
Comment pep:novel scaffold:Myoluc2.0:GL430997:11129:18582:1 gene:ENSMLUG00000026322 transcript:ENSMLUT00000026885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRWHLFSPEDTPFLYPTRIPYEESSVFSKVNVVNPDVKRFPQFQKARRHVVTLSPGQVL
FVPRHWWHYVESVDPVTVSINSWIELEEDHQARVEEAIARMLVCALKTAEDPHSTRAWLN
PTEVEETSHEVNCRYLNRAVSAFFDHYRTSKTEIQALRTHGEHMEKEEFNMHNNLMEVDQ
TGSQNLTLGTVGEQAACPFGPDLVPVLPSSENPPSETGGMFKNDGKDFVGKAGEHFDKLH
CTKKQRMMRGRENEIVEQVASNSTMAPSQTFISTDDLLDCLVNPQVTKIVAQLLIQGRSL
Download sequence
Identical sequences G1PY39
ENSMLUP00000016371 ENSMLUP00000016371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]