SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016407 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016407
Domain Number 1 Region: 224-435
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-47
Family Protein kinases, catalytic subunit 0.000000417
Further Details:      
 
Domain Number 2 Region: 32-147
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-31
Family SH2 domain 0.00000778
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily SH3-domain 0.000000675
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016407   Gene: ENSMLUG00000024443   Transcript: ENSMLUT00000023559
Sequence length 446
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:36149312:36162508:-1 gene:ENSMLUG00000024443 transcript:ENSMLUT00000023559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEHFVVALYDYVAVNDRDLQMLKGEKLQILKESGDWWLAKSLITGREGYVPSNFVARVET
LEVEKWFFKSISRKDAERQLLAPINKVGSFLIRESETNKGAFSLSVKDVTTQGEVIKHYK
IRSLDEGGYYVSPRITFPTLQALVQHYSNGSPRGQRMVKSHLSSSPASKPCSGHASASPR
VHMHAHTHKHSNSMPFWARLCLLYRMECTAALQPQPQGQKSAREHLAHMFSLASCTLYSP
HSIIPDKSIHLETEGENQGTLLQKLCFQQAKSPCCPSLCGMFPQIAEGMAYIEKMNSIHR
DLRAANILVSETLGCKIGDFGLARIIDNEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVW
SFGILLMEIVTHGRVPYPGMSNPEVIRSLERGYRMPRPDSCPPELYRGVIAECWRSRPEE
RPTFEFLQSVLEDFHTATERQYELQP
Download sequence
Identical sequences G1PY75
ENSMLUP00000016407 ENSMLUP00000016407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]