SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016428 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000016428
Domain Number - Region: 84-124
Classification Level Classification E-value
Superfamily SH3-domain 0.00834
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016428   Gene: ENSMLUG00000026397   Transcript: ENSMLUT00000029156
Sequence length 125
Comment pep:novel scaffold:Myoluc2.0:GL430188:152985:155200:1 gene:ENSMLUG00000026397 transcript:ENSMLUT00000029156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWSRVFLGVILLSAFPGPTVGGRSMPKLADWKLCADEECSYPSHAVALRTTEWVTTSAG
QGGFRTDPWRASTKIFRSCELVQGDYYGDLAARLGFFPSSIVREDQTLKPGKIDVKTDKW
DFYCQ
Download sequence
Identical sequences G1PY96
ENSMLUP00000016428 ENSMLUP00000016428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]