SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016469 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016469
Domain Number 1 Region: 195-281
Classification Level Classification E-value
Superfamily RING/U-box 9.9e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 283-343
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000016469
Domain Number - Region: 332-401
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00107
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 3-125
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0921
Family IMD domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016469   Gene: ENSMLUG00000027922   Transcript: ENSMLUT00000023318
Sequence length 474
Comment pep:novel scaffold:Myoluc2.0:AAPE02063539:839:14402:1 gene:ENSMLUG00000027922 transcript:ENSMLUT00000023318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEKLQEAVRKLRQLEEECTNQKAFTVKQIAQWEEKIEAQRQKIQADFQKLHSFLREEERS
YLRKLESEEQRTLQRLRDSEADLDQQSRELESHILELEERCQGSAQKLLQKSENCDLAQN
MVFWLLSHPGALPTRLRKWLRSHQDVRQMLLKLVELRSRRCPGALWGEETADEPLGSAPH
TRAFGRGMASASASKKMWEEATCSICLHLMAEPVSISCSHSYCQACLLRFMGPPSSPRSQ
QNTDTFSCPQCQAPLQRGSLRPNKQLGSLIAALREQEQEQEQEQELSCEEHGERLHLFCE
DDGQLICWRCERHGQHKGHNTVLVEDVSPGYREKLQEAVRKLRQLEEECTNQKAFTAKQI
TQWKKKIEAQRQKIQAEFQNLHSFLREEERSYLWRLESEEQRTLQRLRDSEADLDQQSRE
LKYHIRELEERCQGSAQKVLQDVKGALSRSQAVRLETPEALSLEIETKYKVPEL
Download sequence
Identical sequences G1PYD7
ENSMLUP00000016469 ENSMLUP00000016469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]