SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016471 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016471
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.22e-26
Family Ubiquitin-related 0.000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016471   Gene: ENSMLUG00000022198   Transcript: ENSMLUT00000024569
Sequence length 123
Comment pep:novel scaffold:Myoluc2.0:GL429777:15709346:15709717:-1 gene:ENSMLUG00000022198 transcript:ENSMLUT00000024569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLTGKTINLEVEPSDTIENIKAKIQDKEGILPEQQCLISVGKQLEDGRTLTDCNIQKVS
TLHLVLRLRGGIIKPALHQLAQKYNCDKMICHKGYSHLHPRTVNFHKKKCDHTNNLCPKK
EVK
Download sequence
Identical sequences G1PYD9
ENSMLUP00000016471 ENSMLUP00000016471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]