SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016486 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016486
Domain Number 1 Region: 92-314
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.33e-38
Family TehB-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016486   Gene: ENSMLUG00000023479   Transcript: ENSMLUT00000022947
Sequence length 495
Comment pep:novel scaffold:Myoluc2.0:GL429767:28177058:28178542:-1 gene:ENSMLUG00000023479 transcript:ENSMLUT00000022947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTRESSAYIAAMVSNEPSGRIMTFHPTMEEFKDFNKYIGYMESQGAHRAGLAKVIPPKE
WKARQTYEDVSDMVIATPLQQVASGRAGVFIQYHKKKRAMTVGEYRLLANSGQYQTPPHL
DFEDLERKYWKTRLYNSPIYGADISGSLFDANTKQWNLCHLGTIQDLLEQECGVVIEGVN
TPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWYAVPPEQGPRLERLARELFPGSSR
GCQAFLRHKVALISPTVLKENGVPFSRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFA
TPRWVDYGKVASQCSCGEARVSFSMDVFVRLLQPERYELWKRGQDRTVVDHVELGLRQLQ
PCRATHTPGSVGTGRGSRGHRGSQALVRKPCLRPSLGHGSASAAQPAAAAALCSSKPNPS
SQPPSGPSAQDLQPTGTRGGGSGRRPREQGTQESIVQVPAKRRRLVGAVLTAPDPKAQPV
PEDKPSMDSQALLVP
Download sequence
Identical sequences G1PYF4
ENSMLUP00000016486 ENSMLUP00000016486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]