SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016514 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016514
Domain Number 1 Region: 280-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-42
Family SPRY domain 0.0000958
Further Details:      
 
Domain Number 2 Region: 8-82
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 86-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000148
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016514   Gene: ENSMLUG00000023565   Transcript: ENSMLUT00000028993
Sequence length 470
Comment pep:novel scaffold:Myoluc2.0:GL429873:462142:469764:-1 gene:ENSMLUG00000023565 transcript:ENSMLUT00000028993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LECMDLLQVMQNELTCTICMNYFLDPVTLDCGHSFCRPCLFLSWDATQTPMCCPHCRQVS
KKSDLKTNTQLRNMASLARQARDDPVDGSQEQICEAHDAAKWVFCDADKNLLCGLCSDSL
EHMLHNHRPTQRAAEEFREKLLKRMADLWNMSKQLQNNLKLETCKAESLEEYVDIRKVMI
RAEYQKLHQFLCEEERLHLVVMEKEANEYLDKLEESKIRIIQQIENQREMFRELKDMCHK
SDVELLQDLGTVMERTELVQNQMPQLVNPDLTSWCSTGLLDMLSRFKVDNVLTAETISQI
MSLSEDVRGVLFGNNHHTMPREPQRVRSFAAWGNHTFISGRHYWEVDVPRSSNWVLGVCK
DILIRESDFIIDFKESSLLFALKLNDHYYLSTNRPLLVHHVKMPVGKIGVFLDYDKGIVS
FHDAADGSLLCSLAPSTFSFPLKPFRCVDAAYWEPSGDVLLMEVTGLIRG
Download sequence
Identical sequences G1PYI2
ENSMLUP00000016514 ENSMLUP00000016514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]