SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016592 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016592
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-19
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Domain Number 2 Region: 75-134
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000014
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016592   Gene: ENSMLUG00000010327   Transcript: ENSMLUT00000022761
Sequence length 281
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430520:167859:172826:1 gene:ENSMLUG00000010327 transcript:ENSMLUT00000022761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLRQELSCPLCLQLFDAPVTAECGHSFCRACLSRVAGEPGADGTAPCPSCQAPT
RPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLL
PAAEAHARLKLQLELLELVRRQVLQRVQDGVALLPHGSAAPSDGASGPAELDVRVWTGRL
EFGRWRKELELARSRAGGRALREARTFHLSKLKIQQRALLLALPRPMPPPKVPSQTLPIP
PRLQKILAESPPPARLDIQLPVISDDFKFQVWRKMFRALMP
Download sequence
Identical sequences G1PYR0
ENSMLUP00000009419 ENSMLUP00000016592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]