SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016641 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016641
Domain Number 1 Region: 273-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-44
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily RING/U-box 3.76e-18
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 78-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000029
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016641   Gene: ENSMLUG00000030730   Transcript: ENSMLUT00000002956
Sequence length 444
Comment pep:novel scaffold:Myoluc2.0:GL429890:365255:366589:-1 gene:ENSMLUG00000030730 transcript:ENSMLUT00000002956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCPICLDYLRDPVTTECGHNFCSSCIHQHWEGLQGTFSCPVCLHHGPDRSWKRNTQLY
HMTEIVQQIPGMRGKRKRPEEPLCKKHREGLSLFCEKDLEVLCAQCRVSDHGDHPLIPIE
EAAATHRRKLKSYIESLNEQIKDTENRSEMQVSKCSELRQRIEHQKDELHSEIKQLKNFL
EKEQNAMLISLLTETTNVEEKLMEEKKQISNHSSILNSQLSDIISKCLQIDVDLLTGVES
IHNRYDNLETLATLLYELKEESCSLPPHYLGLHKMIHTFQVDLTLDPETAHPSLTISRDR
ISVTYRTSFGLHNLQARTSYPAVLSSKGFDAGRHFWQVEVRGTGAWCLGVCKESFPKNAP
MPPSPRNGCWQLQFWANTSVTWDSGNWERIGIFLDYELGEVSFYNLRTRSHLYTFSERFT
VKLMPYFCIGLFTKSLVMRIVKDE
Download sequence
Identical sequences G1PYV9
ENSMLUP00000016641 ENSMLUP00000016641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]