SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016776 from Myotis lucifugus 76_2.0

(show help)
Strong hits

Sequence:	ENSMLUP00000016776
Domain Number 1	Region: 138-209
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000344
Family	LIM domain	0.011
Further Details:

Domain Number 2	Region: 76-142
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000107
Family	LIM domain	0.011
Further Details:

Domain Number 3	Region: 48-74
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000829
Family	LIM domain	0.045
Further Details:

Weak hits

Sequence:	ENSMLUP00000016776
Domain Number -	Region: 205-234
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00184
Family	LIM domain	0.018
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSMLUP00000016776 Gene: ENSMLUG00000025957 Transcript: ENSMLUT00000030375
Sequence length	251
Comment	pep:known_by_projection scaffold:Myoluc2.0:GL429931:1392424:1413820:-1 gene:ENSMLUG00000025957 transcript:ENSMLUT00000030375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	PAPFPLAFAPLPSGREGPARQKRRLEALTRELERALEARTARDYFGICIKCGLGIYGARQ ACQAMGSLYHTDCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLI MEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTAFAPKCASCARPI LPAQGCETTIRVVSMDRDYHVECYHCEDCGLQLSEDGRRCYPLEGHLLCRRCHLRRLRLG PLPSPVHVTEL
Download sequence
Identical sequences	G1PZ94 ENSMLUP00000016776 ENSMLUP00000016776

SEARCH