SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016856 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016856
Domain Number 1 Region: 80-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000171
Family Ankyrin repeat 0.0059
Further Details:      
 
Domain Number 2 Region: 377-423
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000301
Family SOCS box-like 0.0068
Further Details:      
 
Domain Number 3 Region: 152-276
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000525
Family Ankyrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016856   Gene: ENSMLUG00000011493   Transcript: ENSMLUT00000028428
Sequence length 428
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:29836612:29876812:-1 gene:ENSMLUG00000011493 transcript:ENSMLUT00000028428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDCLPDHPLSSDLVRRLKSALDARDEETVRTVICTQVRHVDAVIELANDDWMKDPSA
QLPPGVLLGLWTLEYTRELTTPLCIAAARGHAACVSTLLRGADPNASPEAWPLHEAAWGP
TLGQLLLRPRRPDLVGLEAAEGAHLWGRPLSPKCAQALLEHGASVHRAGPGLDTPLHVAA
QHGGGRAACDDSLRLSFSGPQCARGSEGSAAARTASDPTCRRGSAALRARARPSPCTRLC
LGAGRRRTRPTRTSSSPLHKACGHARPGLALLLLRARGRRGRARLRKAPRPWARVLQAAA
CAPQAAPQRTVQALLNHGSPTLWPDAFPKVLQTCAPAPAVIEVLFNAYPQLRVSESWREV
IPEEVFQAHRPFYQSLFALAGSPRRLLHLCRCAIRRRFGKQCSRLVPLLPLPATLQSYLL
LEPEGVLH
Download sequence
Identical sequences G1PZH4
ENSMLUP00000016856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]