SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016868 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016868
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-54
Family SPRY domain 0.000059
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-21
Family RING finger domain, C3HC4 0.0038
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000087
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016868   Gene: ENSMLUG00000030706   Transcript: ENSMLUT00000024510
Sequence length 468
Comment pep:novel scaffold:Myoluc2.0:GL429828:3396641:3398047:1 gene:ENSMLUG00000030706 transcript:ENSMLUT00000024510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEGAVAKLQTEINCPICLDNLRHPVTIECGHNFCRFCIERSWADVQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKLLQITGAKVKQQEERRLCEKHNQALTLFCEEDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQVRQRSELREKVEKRR
AKLACEYESVIASIECEQAAVHSRLAAQEKHILQNLTANKAAFSDHISKLRVLRKEMAEM
SVLSDVKLLMNIKGVPPRCDNLEPPDVYCIKYKREEFSLPPQCSALLQIMQTFREEVTLD
PETAHANLLVSEDKKSVTFVRKKQGVHWNPKGFADDAVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCKDPLSKERKQPLLRQEKRCWTIQLQDGDYVARGPVSVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1PZI6
ENSMLUP00000016868 XP_006089747.1.53796 ENSMLUP00000016868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]