SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016884 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016884
Domain Number 1 Region: 748-824
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 1366-1440
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000108
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1477-1553
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000108
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 919-1054
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000109
Family Fibronectin type III 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000016884
Domain Number - Region: 233-244
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016884   Gene: ENSMLUG00000002845   Transcript: ENSMLUT00000002843
Sequence length 1557
Comment pep:novel scaffold:Myoluc2.0:GL430043:611524:616233:1 gene:ENSMLUG00000002845 transcript:ENSMLUT00000002843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLREREAEIRQLLRWKEAEMRQLQQLLHRERDGVVRQARELQRQLAAELVNRGYCGRAGA
PKAAAAAQCRCRLQEVLAQLRWETDGEQASRIRHLQAALDVERQLFLKYVLEHFRWHPVL
PGTPDPQAVPSSEEPHPETASDSHRPPKSPKVRLESLDGLSAGVRVRSRSLEMVPAACSN
SRDNLLPTRSGSLDSLAPGRSHSLDSLLGRPKAPESEERASSADTFILGFLSPPPPPTSP
PPPPTPTPPLSPPPRGPSDRTGEDSRSQPCEALALSPLSLDYQELVKQNSELSEALQVLA
RRCSDLLDENMQLRRTGFPDQADEKVKRLKVKHAELTGLARRLEDRARKLQETNLRTLSA
PVPGESRVGLELCQDFASQRARDLSEQASALLAKDKQIEELQQECRLLQAHVASGLGSAP
HADGGAASAQWLKVSDLDRLQRESQREVLRLQRQLTLQKATRSGRGEPSGRKAPGEGARC
QVQALERELSARRQECQELGAQAAAAQRRGEEAEAQLQTALCEGAWLAKENARLQAQADW
TRKLAAENNDVREQLGRACQERDATGLLVEQLLQQAAREQDKQQQLQRDLQKALRDLEAA
RGEMGVLRCQPDHHPQQPLETSQAPDSQGRKSRKTRFQPGPEDQASLQSSRDKQEEDASL
LESPLALGEPASAPQGPDRVPDRVPASQPLDCRPQAKKTSSQSNSSSEVESVWATVPSCL
TLDMDTASEVEDLDPDSASLTLEVGDSEAPAAPKLKIFLVRYSYNPFEGPNEHPETELPL
TAGEYVYIFGEMDEDGFYEGELEDGRRGLVPSNLVVQIPDNDILGCLPPESSDPGPTQLP
AGQGKTSKEDISHSFLPGEAQGAVDRETCQMARAASKTEVAMETSDAKTEDGWLGSRRSV
EEQGFSRPLLGPKGVPCVAPKQLRVQNVVATSAKIVWVYSSCCRPHVVYLNDQKHALTPA
GVSTYTFHNLHPSTRYQVQVEVQLPWDSMQMRWETMSSTLTFDTPLAGPPDPPLDVLVER
HTLPGLLVVSWLPVTIDLAGFSNGVRVTGYAVYADGLKVAEVTDATAGSTLLELSRLQLP
LMCQKVSVRTISLCGESLDSVPAQIPQDCWNCNGLPETSPFTYTPGDQSPCRITFPVCPQ
RLALAPPSAKASSHIPRSCGGSLEAFPEEPPRKHSPMPNLSPEGECPGAGAGSQTQGPAE
AWEVCRKDLLFQKSPRNHRPSLHQSQGEEDHDRHMDTSQSPALGVLHLSPEFAPRREACQ
EKAALEKALRQKQDAQVLTPPQIGTRQRHMSDFHDILQQEEEAACFGPWATERQEQRREL
RAQSRRGQALWGERESQLQEPSSAPCPASSSKVLPVSGGGPPQLEAGRDTAGRVFVALFD
YEPLVMSANPEAAEEELAFQKGQLLRVWGSQDTHGFYRGECNGQVGNIPGHLVAEVEDGL
ERTDSRWHLPVQGHLPSVAHLDEVGGLTIPQDSFPLPQGNPRGPPLCTRMTMMAALDYDP
KDGWAGGQAKGKLSLKAGDLVTVYGPVDDRGFYYGESGGHRGLVPAHLLDYMSLHDE
Download sequence
Identical sequences G1PZK2
ENSMLUP00000016884 ENSMLUP00000016884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]