SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016944 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016944
Domain Number 1 Region: 3-187
Classification Level Classification E-value
Superfamily Ferritin-like 1.32e-62
Family Ferritin 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016944   Gene: ENSMLUG00000024101   Transcript: ENSMLUT00000027605
Sequence length 189
Comment pep:novel scaffold:Myoluc2.0:GL429828:1277982:1278548:-1 gene:ENSMLUG00000024101 transcript:ENSMLUT00000027605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQIRQNYSTEVEAEVNRLANLHLQAFYTYLSLGFYFNRDDVASQGVGHFFRVLEEKKF
KGAELLFKMQNQRGGRIVLHDVQKPSQHEWGTTQDAMEAALDLEKNLNQALLKLHALGSA
HKDPHLSNFLEKHFLDEEVKLIKKMGDQLTNLRRLASSQAGLDSPQAGLDSPQAGLGEYL
FERLTLKHH
Download sequence
Identical sequences G1PZR2
ENSMLUP00000016944 ENSMLUP00000016944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]