SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016976 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016976
Domain Number 1 Region: 47-223
Classification Level Classification E-value
Superfamily Ferritin-like 8.4e-61
Family Ferritin 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016976   Gene: ENSMLUG00000029845   Transcript: ENSMLUT00000026523
Sequence length 224
Comment pep:novel scaffold:Myoluc2.0:GL429767:11798466:11799171:-1 gene:ENSMLUG00000029845 transcript:ENSMLUT00000026523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSRICLLLQQCLDGTDPGMPLLPASGHSPVSYPLTTFRTTLRTSQHRFCCLTTMSSQIC
QNYSTEVEAAVNRLAKPHLRASYTYLSLGYYFDRDDVALEGVGELAEKKREGAEHLLKLQ
NKRCGRILFQDVQKPSQDEWGKTQDAMEAALALEKNLNQALLDLHALGSTRVDPHLCDFL
ENHFLDEEVKLIKKMGDHLTNLRRLAGPQAGLGEYLLERLTLKH
Download sequence
Identical sequences G1PZU4
ENSMLUP00000016976 ENSMLUP00000016976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]