SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016977 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016977
Domain Number 1 Region: 15-164
Classification Level Classification E-value
Superfamily Ferritin-like 3.76e-36
Family Ferritin 0.00000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016977   Gene: ENSMLUG00000026608   Transcript: ENSMLUT00000024059
Sequence length 175
Comment pep:novel scaffold:Myoluc2.0:GL429777:11969908:11971107:-1 gene:ENSMLUG00000026608 transcript:ENSMLUT00000024059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNSLLPNNHELPNSSELFHTANHLVSLHLRASYTYLSPGFYFDCDDVALECVGHFFPELV
EKKHEGTERLLKMQQQHILFQDVLKPSQDEGETQDTKEATMVMEKSLNQVLLQLQALGST
STDPHLCDFLQNHFLSEEVKLIKKMGHLIHLRRLADSQAGWLGLRIRLKLVLRHP
Download sequence
Identical sequences G1PZU5
ENSMLUP00000016977 ENSMLUP00000016977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]