SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017017 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017017
Domain Number 1 Region: 134-185
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000025
Family Hermes transposase-like 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000017017
Domain Number - Region: 19-87
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family Arfaptin, Rac-binding fragment 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017017   Gene: ENSMLUG00000026386   Transcript: ENSMLUT00000027767
Sequence length 210
Comment pep:novel scaffold:Myoluc2.0:GL430259:26384:27100:-1 gene:ENSMLUG00000026386 transcript:ENSMLUT00000027767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLKLKGKSDEFTELNQYVHDMYTNVKAFKSKLIFFSRQISDKVFTHFATLATQKKTIQNV
KKYIKSLDDLHAEFCRQFSDVEKIDQSLQLVACPLSQNPETVPEEVQLELIDLQSDFVLK
EKFSSLELRDFYASLNEATFPNIRRMAQKILVLFGSTYVCEQTFSVMNINKAPHRSSLTD
EHLRSILRIATTKLTPDFDALAKKGDQQHC
Download sequence
Identical sequences G1PZY5
ENSMLUP00000017017 ENSMLUP00000017017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]