SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017025 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017025
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000889
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Domain Number 2 Region: 127-195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000322
Family Ubiquitin-related 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017025   Gene: ENSMLUG00000029355   Transcript: ENSMLUT00000025837
Sequence length 226
Comment pep:novel scaffold:Myoluc2.0:AAPE02065762:1580:8815:1 gene:ENSMLUG00000029355 transcript:ENSMLUT00000025837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEMDIVVFEDL
NGAVKFSSSLPYPNNLNSILLQRLEKWLQLMLMWHPRQRGTDPAYGPNGCFKALDDILNL
KLVHILNMVTGTIHTYPVSEDESLQSLKARIRQDTGIPEEDQELLQEAGLALISDKPATQ
CISDGKLNEGHTLDMDLVFLFDNSKVTYETQISPRPQPESVSCIRK
Download sequence
Identical sequences G1PZZ3
ENSMLUP00000017025 ENSMLUP00000017025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]