SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017066 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017066
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000222
Family Ubiquitin-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017066   Gene: ENSMLUG00000024279   Transcript: ENSMLUT00000024104
Sequence length 130
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429840:3973789:3975680:1 gene:ENSMLUG00000024279 transcript:ENSMLUT00000024104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADENPKEGVKTENQDHINLKVAGQDGSVVQFKIKRHAPLSNLMKAYCERTKKTFSIRKL
QFGFNTSDYHNKVTDVCAEAFEFFSTKWPMKNQVFCNSSKPSQFDKNIGTIYPFPLPNPL
FPSAYLKPCF
Download sequence
Identical sequences G1Q034
ENSMLUP00000017066 ENSMLUP00000017066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]