SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017079 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017079
Domain Number 1 Region: 120-200
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000106
Family Translational machinery components 0.015
Further Details:      
 
Domain Number 2 Region: 46-107
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000345
Family Ribosomal S5 protein, N-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017079   Gene: ENSMLUG00000029122   Transcript: ENSMLUT00000026146
Sequence length 235
Comment pep:novel scaffold:Myoluc2.0:GL430026:1556853:1557595:1 gene:ENSMLUG00000029122 transcript:ENSMLUT00000026146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEIKDWTPITKPGRLVNDMIKSLEEICHFSLLIKESIIDFFLEALLKVEALKIMYMQKQT
HGQRTWFKAFVVFVDYGHVSLGVKCSKEVATAVCGVIILAKLSVVPVQGGYQGNKIGKSH
TVPCKVTGHCGSVLVASSLPPRATGIDSAAVPKKLLLLASIHNCYTSSRRCTASLGNFAE
ATFEAISKTYSCLTPDPWKETMFTKSPYQELTDHLVKIHTKVFVQRIRAPAVATT
Download sequence
Identical sequences G1Q047
ENSMLUP00000017079 ENSMLUP00000017079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]