SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017148 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017148
Domain Number 1 Region: 288-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-55
Family SPRY domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-20
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000458
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000017148
Domain Number - Region: 134-195
Classification Level Classification E-value
Superfamily t-snare proteins 0.0942
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017148   Gene: ENSMLUG00000028427   Transcript: ENSMLUT00000025925
Sequence length 468
Comment pep:novel scaffold:Myoluc2.0:GL429768:23316062:23317468:1 gene:ENSMLUG00000028427 transcript:ENSMLUT00000025925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEEAVAKLQTEINCPICLGILGDPVTIECGHNFCRFCIQHTWADLQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKHLQITVAKMKQQEQKRLCEKHNQALTLFCEDDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQDRQQSELREKVEKQR
VKLASEYESVLASIECEQAAVHSRLAAQEKHILQNLIANKAAFSDHISKLRALRKEMAET
SVVSDVKLLMNIKGVLPRCENLEPPGVYCFQFSREEFSLPPQCSALQKIIQRFREEVTLD
PETAHANLLVSEDKKSVTFVRKKQGVHRNPKGVADDPVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCKDSLSKERKQPLLRQENRCWTIQLQDGDYVAHGPVPVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1Q0B6
XP_006082059.1.53796 ENSMLUP00000017148 ENSMLUP00000017148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]