SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017210 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017210
Domain Number 1 Region: 67-207
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-43
Family Third domain of FERM 0.000000424
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-18
Family Second domain of FERM 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017210   Gene: ENSMLUG00000010311   Transcript: ENSMLUT00000022918
Sequence length 379
Comment pep:novel scaffold:Myoluc2.0:AAPE02062218:5475:21882:1 gene:ENSMLUG00000010311 transcript:ENSMLUT00000022918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYL
KIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSD
KEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREE
KARKQMERQRLAREKQMREEAERTRDELEKRLLQMKEEATMPNEVLMRSEETADLLAEKA
QITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRVMEQKVLEAEVLALKMAEESERRA
KEADQLKQDLQEAREAERRAKQKLLEITTKPTYPTFPINPIPALLPPDMSSFNLIGDSLS
FDFKDTDMKRLSMEIEKEK
Download sequence
Identical sequences G1Q0H8
ENSMLUP00000009407 ENSMLUP00000017210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]