SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017214 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017214
Domain Number 1 Region: 266-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.000000000102
Further Details:      
 
Domain Number 2 Region: 153-297
Classification Level Classification E-value
Superfamily SH2 domain 3.27e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 65-163
Classification Level Classification E-value
Superfamily SH3-domain 1.47e-22
Family SH3-domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017214   Gene: ENSMLUG00000004480   Transcript: ENSMLUT00000029596
Sequence length 543
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:6811643:6829576:1 gene:ENSMLUG00000004480 transcript:ENSMLUT00000029596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRRSLEPAENAHGGGGGGAFPTSQTPSKPASADGHRGSNTAFSPATA
EPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRK
VDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRG
TFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY
SKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
RVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFL
KGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARL
IEDNEYTARQGGQVPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNRE
VLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPG
ENL
Download sequence
Identical sequences G1Q0I2
ENSMLUP00000004080 ENSMLUP00000017214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]