SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017245 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017245
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-36
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000017245
Domain Number - Region: 147-246
Classification Level Classification E-value
Superfamily PH domain-like 0.00442
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017245   Gene: ENSMLUG00000006542   Transcript: ENSMLUT00000026256
Sequence length 352
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429855:506017:539043:1 gene:ENSMLUG00000006542 transcript:ENSMLUT00000026256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKVIPLKM
CFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVLAEL
NAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAW
ASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSTWTR
ILVQGCHAAAELIKEVSLDHGPALLSEADCICAAHVLVGQSHSHGTACMSSKNQKRALNV
IRSIFTSKKKHKKKSLCSPPAQCLDKDLRITAEPQPRLKRSLPFTSYRGQNF
Download sequence
Identical sequences G1Q0L3
ENSMLUP00000005975 ENSMLUP00000017245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]