SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017267 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017267
Domain Number 1 Region: 112-212
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-25
Family SH2 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017267   Gene: ENSMLUG00000025811   Transcript: ENSMLUT00000027241
Sequence length 418
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:1176083:1185292:1 gene:ENSMLUG00000025811 transcript:ENSMLUT00000027241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLAQISPQGSHNTPPPTFTTFQPLDFTRKSCQDLLKETRLQALQAGEAPFSPRAPDV
HAVASPQAPGAASSQEDTGKAEEVPKEGGQSLQAETRAWFQKTQARGLLQRGAAPPWFHG
FITRREAERLLETKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDS
AHARLQDLLRHYSGSPLSPYGETLSQPLARQTPEPAGLSLRTEEADAASKSQDPHPQYSP
VLKKEKPRALMQKEGGSEPKEPSQPPRPKPPVPAKPLLSSEAYTSPAPRLCRTLPAKPSN
PIYHEPDEPIAFYAMGRGSPGEAPSNIYAEVEVEMEVPSGGEGPSCILWHPVLRKCRSRP
LPGRQNPGGQQLHSENSVAGQGPPVPRQPLPLWGHSLPHNLDRFQDRGETWPSLGPPQ
Download sequence
Identical sequences G1Q0N5
ENSMLUP00000017267 ENSMLUP00000017267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]