SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017472 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017472
Domain Number 1 Region: 53-104
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000025
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017472   Gene: ENSMLUG00000024304   Transcript: ENSMLUT00000022182
Sequence length 109
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429819:1552341:1612996:-1 gene:ENSMLUG00000024304 transcript:ENSMLUT00000022182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPGWPRLVIGSLPAHLSPHLRGRFKCPVCSKFVPSDEMDLHLVMCLTKPRITYNEDVLS
KDTGECAICLEDLQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD
Download sequence
Identical sequences G1Q189
ENSMLUP00000017472 ENSMLUP00000017472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]