SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017489 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017489
Domain Number 1 Region: 29-77
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000179
Family Ribonuclease PH domain 1-like 0.00022
Further Details:      
 
Domain Number 2 Region: 93-165
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000114
Family Ribonuclease PH domain 2-like 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017489   Gene: ENSMLUG00000023828   Transcript: ENSMLUT00000029816
Sequence length 172
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429855:4076384:4077231:1 gene:ENSMLUG00000023828 transcript:ENSMLUT00000029816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGDHRRIRGPEESQPPQLYAAEEDEAPDPRDPSRLRPVYARAGLLSQAKGSAYLEAGGT
KVLCAVSGPRQVADIKLTTGGGLRLNRWPGPAPTWFAGPTRLKEERAAACLTVALMPVLN
QVGRAAGAVGRGGPTESWVEVRMGLEGCQRLYPVLQQCLVRAARRRSAAAPS
Download sequence
Identical sequences G1Q1A6
ENSMLUP00000017489 ENSMLUP00000017489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]