SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017501 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017501
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily PX domain 2.45e-20
Family PX domain 0.00068
Further Details:      
 
Domain Number 2 Region: 100-164
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017501   Gene: ENSMLUG00000027356   Transcript: ENSMLUT00000025013
Sequence length 191
Comment pep:novel scaffold:Myoluc2.0:GL431566:2349:28092:-1 gene:ENSMLUG00000027356 transcript:ENSMLUT00000025013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMQMLDKFPMEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPY
ISQCDEVLQFFETRPEDLNPPKEEHVGKKKSATGSDPTSVDPMVLEQYVVVANYQKQESS
EISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQDAGQDEFSLEPEEGALGSWA
LTPPWNDPGSQ
Download sequence
Identical sequences G1Q1B8
ENSMLUP00000017501 ENSMLUP00000017501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]