SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017586 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017586
Domain Number 1 Region: 71-208
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-38
Family Phosphotyrosine-binding domain (PTB) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017586   Gene: ENSMLUG00000022775   Transcript: ENSMLUT00000026806
Sequence length 276
Comment pep:novel scaffold:Myoluc2.0:GL430885:1:5917:1 gene:ENSMLUG00000022775 transcript:ENSMLUT00000026806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASLADRPCEEPPQKPPRFSQLRQCKTCSPRRRPPWSQNDSCTARSADLLLPLWFSCECGE
KSCRNFSMTLRTSSEEVLKNARTLPPQYLGSMLIKDLRGTESTQDACAKMRKSTEHMRKV
PTITLSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLCTFAYITKDLQTGHHYCHV
FSTVDVTLTYEIILTLGQAFEVAYQLALQAQRARPVGASAAEPVETRSSKPVPKPRVGVR
KSALEPPDMEPDAQSHASVSWVVDPKPDSKRSLSTK
Download sequence
Identical sequences G1Q1K3
ENSMLUP00000017586 ENSMLUP00000017586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]