SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017587 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017587
Domain Number 1 Region: 92-314
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-35
Family TehB-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017587   Gene: ENSMLUG00000023769   Transcript: ENSMLUT00000024128
Sequence length 514
Comment pep:novel scaffold:Myoluc2.0:GL429873:353865:355406:-1 gene:ENSMLUG00000023769 transcript:ENSMLUT00000024128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTRESSAYIAAMVSNEPSGRIMTFHPTMEEFKDFNKYIGYMESQGAHRAGLAKVIPPKE
WKARQTYDDVSDMVIANPLQQVASGRAGVFIQYHKKKRAMTVGEYRLWANSGQYQTPPHL
DFEDLERKYWKTRLYDSPIYGADVSGSLFDANTKQWNLGHLGTIQDLLEQECGVVIEGVN
TPYLYFGMWKTTFAWHTEGMDLYSINYLHFGEPRMWYAVPPEHGPRLERLARELFPGSSR
GCQAFLRHKVALISPTVLKENGVPFSRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFA
TPRWVDYGKVASQCSCGEARVSFSMDVFVRILQPERYELRNRGQDRTVVDHVEPRAPGSQ
ELSAWREGRAAWRSAPGLRHHQPRRATHTPRSVGTGCGYGRRHTLVHQPCLRPSLGRGSA
SAAQPAAAAALCSSKPNPSSQPPSGPAAQDLQPTGTRGGGSGRRPLEQGTQESIVQVPAK
RRRLVGAVRTAPDPKVQPVPEDKPSMDSQALLVP
Download sequence
Identical sequences G1Q1K4
ENSMLUP00000017587 ENSMLUP00000017587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]