SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017602 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017602
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.07e-75
Family Cyclophilin (peptidylprolyl isomerase) 0.000000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017602   Gene: ENSMLUG00000029645   Transcript: ENSMLUT00000027512
Sequence length 164
Comment pep:novel scaffold:Myoluc2.0:GL429808:5806714:5807225:1 gene:ENSMLUG00000029645 transcript:ENSMLUT00000027512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVYFDIAADGEPLGRVSFELFADKVPKMAENFRALTTGEKGFCYKSSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFVLKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKYVVFSRVKEGMDIVTAMERFGSRNGKTSKKITIADCGQL
Download sequence
Identical sequences G1Q1L9
ENSMLUP00000017602 ENSMLUP00000017602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]