SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017682 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017682
Domain Number 1 Region: 8-86
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000183
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017682   Gene: ENSMLUG00000022270   Transcript: ENSMLUT00000030524
Sequence length 86
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429857:4401610:4401867:1 gene:ENSMLUG00000022270 transcript:ENSMLUT00000030524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGRFDFDDGGAYCGGWENGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTF
EGYWSQGKRHGLGIETKGRWLYKGEW
Download sequence
Identical sequences G1Q1U9
ENSMLUP00000017682 ENSMLUP00000017682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]