SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017739 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017739
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily Ferritin-like 2.01e-25
Family Ferritin 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017739   Gene: ENSMLUG00000030163   Transcript: ENSMLUT00000026539
Sequence length 79
Comment pep:novel scaffold:Myoluc2.0:GL429768:21460862:21461101:-1 gene:ENSMLUG00000030163 transcript:ENSMLUT00000026539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAALALERNLNQALLELQALGSTRADPHLCDFLENHFLDEEVKLIKKMGDHLTNICRLA
GPQAGLGKYLLERLTLKQD
Download sequence
Identical sequences G1Q206
ENSMLUP00000017739 ENSMLUP00000017739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]