SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017882 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017882
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.3e-31
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017882   Gene: ENSMLUG00000022396   Transcript: ENSMLUT00000028785
Sequence length 117
Comment pep:novel scaffold:Myoluc2.0:AAPE02072420:3838:4897:-1 gene:ENSMLUG00000022396 transcript:ENSMLUT00000028785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIPELKQDISIPDYCCLGDGEEEEITINAWFGPPGTVSPLHQDPQKNFLAQVLGRKYIRL
YSPQESEAVYPHDTHLLHNTNQVGLENPDLKNFPRFAEPFLSCILSPGELLFIPVKY
Download sequence
Identical sequences G1Q2E9
ENSMLUP00000017882 ENSMLUP00000017882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]