SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017883 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000017883
Domain Number - Region: 106-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00034
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017883   Gene: ENSMLUG00000003297   Transcript: ENSMLUT00000008696
Sequence length 473
Comment pep:known_by_projection scaffold:Myoluc2.0:AAPE02068193:492:3867:1 gene:ENSMLUG00000003297 transcript:ENSMLUT00000008696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQNSSAPLAEDMDPELARYLNRNYWEKKQEEARKSPTPSAPAPLAEPAAQPVETHAAPA
AAVETSLPETDPQPITSSGGLFSEQFQNGESEESHAQFLKALQNAVSTFVNRMKSNHARG
RSITNDSAVLSLFQSINSMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREE
HREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQLRLEQQ
KQTIQMRAQMPAFSLPYAQLQAMPAAGGVLYQPSGPTSFPGTYSPAGSVEGSPMHTVYMS
QPAAAAGSPYPSVPGAGAGNPSVVSTYMYPAGVPGAQTAPQGPAGPAASPAYSSYQPTPT
QGYQVGSSHSSQAFPPQTVPSQPPQPAGVGYMGSQAVSMGYQPYSMQNLMTALPSQDASL
QPPPQPYISGQQPMYQQMAPAGGPPQQPPPVAQQPPAQGLQVQGSEAQLISFD
Download sequence
Identical sequences G1Q2F0
ENSMLUP00000003003 ENSMLUP00000017883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]