SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017892 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017892
Domain Number 1 Region: 72-279
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.02e-69
Family AlkB-like 0.00000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017892   Gene: ENSMLUG00000029289   Transcript: ENSMLUT00000025700
Sequence length 286
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429980:875140:903542:-1 gene:ENSMLUG00000029289 transcript:ENSMLUT00000025700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKRRRARVQGAWAGSAKSQAVAQPATTAKSHLRQSPGQTWTNKEHHLSDKQFVFKEPQ
QVVRTAPEPRVIDKEGVYEISQSPTGISRLCLYPGFVDLREADWVLEQLCREVPWKQRTG
IREDVTYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNQIEENTGHTFNSLLCNL
YRNEKDSVDWHSDDEPSLGRCPVIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD
HGTLLIMEGATQADWQHRVPKEYHSRAQRINLTFRTVYPDTRGAHQ
Download sequence
Identical sequences G1Q2F9
ENSMLUP00000017892 ENSMLUP00000017892 XP_006097973.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]